PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT14357
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 223aa    MW: 24452.7 Da    PI: 5.8883
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT14357genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-164691147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l+++v q+G+ +W++Ia+++  gR++k+c++rw++ 
         EMT14357 46 RGHWRPAEDARLKELVGQYGPQNWNLIAEKLD-GRSGKSCRLRWFNQ 91
                     899*****************************.***********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.2374196IPR017930Myb domain
SMARTSM007173.4E-134594IPR001005SANT/Myb domain
PfamPF002492.0E-154691IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-2647110IPR009057Homeodomain-like
SuperFamilySSF466895.24E-1947119IPR009057Homeodomain-like
CDDcd001673.50E-134990No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MAREMNGYFS HPPPPPPVPA PYQEEAAADV DDAEDGSGGQ GKLCSRGHWR PAEDARLKEL  60
VGQYGPQNWN LIAEKLDGRS GKSCRLRWFN QLDPRINRRA FTEEEEDRLM AAHRAYGNKP  120
PTPPPSRAYS GGESDESAST CTTDLSLSSG SAAVPCFYHH QGYDMAPQAH AVTQAFSPSA  180
RSAFSAPSSS SARQQQRRQQ QHEEQDGDKL SLPFFDFLGV GST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-1846119780B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-106HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLN1QVE71e-166N1QVE7_AEGTA; Uncharacterized protein
STRINGMLOC_71066.12e-69(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.17e-46myb domain protein 56